PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0034500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 842aa    MW: 90778.7 Da    PI: 7.8075
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0034500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.85.9e-093879346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +  + +G++ +++Ia+ +  ++t  +c+++++ 
  Spipo23G0034500 38 PWTPEECKIFMEMLAVYGKD-FAKIASFLT-HKTTADCVEFYYR 79
                     8*****************99.********9.*********9985 PP

2Myb_DNA-binding27.28.9e-09244284345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT eE   ++ a   +G + +++I++ +g  R+ +qck ++ 
  Spipo23G0034500 244 DWTDEEKSSFISALSSHGRD-FARISQSVG-SRSMEQCKIFFS 284
                      6*****************77.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-162185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-63285IPR009057Homeodomain-like
PROSITE profilePS5129316.3913485IPR017884SANT domain
SMARTSM007171.5E-93583IPR001005SANT/Myb domain
PfamPF002492.2E-73779IPR001005SANT/Myb domain
PROSITE profilePS5129313.905240291IPR017884SANT domain
SMARTSM007175.5E-7241289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-6242285IPR009057Homeodomain-like
SuperFamilySSF466891.33E-9242291IPR009057Homeodomain-like
PfamPF002491.3E-7244283IPR001005SANT/Myb domain
CDDcd001673.07E-6245283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MPALILDEKE KIRSRFITNN GLVEDPCSFE KERSMINPWT PEECKIFMEM LAVYGKDFAK  60
IASFLTHKTT ADCVEFYYRN HKSEDFEKVK KSLGLRKTAE VVPASTYLVT SSKKWKREIN  120
AVSLDVLRAA SMIAAQDDDN MRVQKFSGRS TFQHHGPPHG PPRQAYATFE VPSEADILRQ  180
EQEASAADVL VGICGAVSRE AMSYSGAKSL DPGEKSSFMA VERRLPSVEG SSSDEGCDDL  240
GSSDWTDEEK SSFISALSSH GRDFARISQS VGSRSMEQCK IFFSKARKCL GLDAILSRSS  300
GADPGRGHTG DSATCTKPSG SKIEQDFTRS SPNASHTASV PAAEIPLQAD PEKRIGQQRE  360
AGVPSPEAFD AKIKNQASLL KVDGPITVKE EDPCVVLAEE KALKADITPN GSLQPGEFSA  420
QHLADNEGEK DASHLTDGPD EGLPGDSLQA GCEPKSEPAD DDRQKEASSR SDNSASSSSS  480
GFISKTNADE GVISLPERKP LDLLPGLHQR PHSVSRVAKR VNARPQPPSL SEDRGGKKQK  540
TFPCGEDLPS SSSSILRGYP LQAATEAPPV LLHDWPKKRG GDACPPEAFL PNSHREDSGG  600
GSRRQHELRP CSNGSLRETE QPVRTGDVKI FGKILSHPPP QRPSSPRKPT AGASRGVPAA  660
PETGSFLAKY PPSCGFVRQT YMPTFTLDGS RCDAVAADVQ KKNGGSGGFQ HQGRVALGHR  720
VPGGGAGGML LGSKGCTGGI SDPVAVIKLH YAARAAGVLA REEESWRADV GSMPLESQHQ  780
VVNLTESEKK KRQAQYSESR KKKNMEKIER KMAAVAREKA WAQRLVELQQ LEAAKKAAMA  840
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-14187994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-14187994NUCLEAR RECEPTOR COREPRESSOR 2
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1788802KKKRQAQYSESRKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.19e-64MYB family protein